PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_011009-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 140aa    MW: 15957.9 Da    PI: 6.7879
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_011009-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.22.1e-191663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ll ++v+++G g+W+++ar  g++R +k+c++rw +yl
    NNU_011009-RA 16 KGPWTAEEDKLLTEYVRLHGEGRWNSVARFAGLKRNGKSCRLRWVNYL 63
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.1071167IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-231266IPR009057Homeodomain-like
SMARTSM007172.2E-161565IPR001005SANT/Myb domain
PfamPF002498.4E-181663IPR001005SANT/Myb domain
SuperFamilySSF466892.97E-231790IPR009057Homeodomain-like
CDDcd001674.32E-121863No hitNo description
Gene3DG3DSA:1.10.10.603.2E-76790IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MAGRLGWGIL EEGWRKGPWT AEEDKLLTEY VRLHGEGRWN SVARFAGLKR NGKSCRLRWV  60
NYLRPDLKRG QITPYEERII MELHARWGNS SASVQEASSE EILWGDLWNL DDIHANLDTA  120
CSTSKASLPN LVTSSPSEFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-15169427104MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262476.12e-60PREDICTED: transcription factor MYB59-like
SwissprotP813918e-36MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A0A0LIF86e-55A0A0A0LIF8_CUCSA; Uncharacterized protein
TrEMBLA5BX463e-54A5BX46_VITVI; Putative uncharacterized protein
STRINGVIT_05s0049g02260.t011e-53(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.11e-48myb domain protein 305